Align glucose transporter, ATPase component (characterized)
to candidate WP_027456480.1 K420_RS0101415 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_000519045.1:WP_027456480.1 Length = 253 Score = 130 bits (327), Expect = 3e-35 Identities = 74/227 (32%), Positives = 123/227 (54%), Gaps = 12/227 (5%) Query: 15 LVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRV 74 L+E+KD+SI FGG+KAV +VS ++ G V ++G NGAGK+TL +++G Y+ GEIR+ Sbjct: 3 LLEVKDLSIHFGGVKAVQNVSFNIDSGIVYSVIGPNGAGKTTLFNLITGVYKPTTGEIRL 62 Query: 75 NGDKVEITNPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGLVD--------- 125 +G+ + +P + + +Q L + N+ A N+ +G L LV Sbjct: 63 DGEAIHGKSPNELARRGVARTFQNLQICMNMSAIENVMVGAHLRLDRNLVKAALRFPSLK 122 Query: 126 --DSAMEAECRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAA 183 D + E ++M+ + Q A+S G + + IARA+ +++ +DEP A Sbjct: 123 QRDRTLRDEAAQLMDFVG-LAQYVETRADAMSYGALKRLEIARALAMKPRLIFLDEPAAG 181 Query: 184 LGPHETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQ 230 L P ET V L++++ GI + L++HD+ VM L DR V+ G+ Sbjct: 182 LNPKETIEVDHLVRKIADSGITVVLVEHDMKMVMNLSDRILVLDYGK 228 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 253 Length adjustment: 24 Effective length of query: 236 Effective length of database: 229 Effective search space: 54044 Effective search space used: 54044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory