Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_027458474.1 K420_RS0113145 3-oxoacyl-ACP reductase FabG
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_000519045.1:WP_027458474.1 Length = 246 Score = 113 bits (282), Expect = 4e-30 Identities = 77/246 (31%), Positives = 116/246 (47%), Gaps = 3/246 (1%) Query: 11 LRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHFIQA 70 L D+ LVTG GIG A+ RQGA V +E ++G I Sbjct: 2 LNDKIALVTGATRGIGRAIALELGRQGATVIGT-ATSEDGAGKISAYLTESGVKGRGIVL 60 Query: 71 DLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFMC 130 ++ + A + +LG++ +LVNNA + ++ WD + NL+ +F + Sbjct: 61 NVTDAAQTDAVLADIAKELGAITILVNNAGITRDNLAMRMGDDEWDAVIDTNLKAVFRLS 120 Query: 131 QAVAPHMQRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRVNA 190 + V M + G IVN SS+ P Y AKAG+ GL++SLA +LG NI VN Sbjct: 121 RGVMRGMMKARFGRIVNISSVVGYSGNPGQANYCAAKAGVAGLSRSLARELGSRNITVNC 180 Query: 191 ILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMTAQAMI 250 + PG I T+ LTEE A M L R +D+ G FL S +++ +T + Sbjct: 181 VAPGFIATDMTHA--LTEEQKAAMLASIPLGRAGTPEDVAGAVGFLVSPAASYVTGTTVH 238 Query: 251 IDGGVF 256 ++GG+F Sbjct: 239 VNGGMF 244 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 246 Length adjustment: 24 Effective length of query: 232 Effective length of database: 222 Effective search space: 51504 Effective search space used: 51504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory