Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_027456806.1 K420_RS0103335 enoyl-CoA hydratase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_000519045.1:WP_027456806.1 Length = 257 Score = 138 bits (347), Expect = 1e-37 Identities = 85/254 (33%), Positives = 135/254 (53%) Query: 1 MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAG 60 +VL E V ++ +NRPE +NA+ E++D + AA+ E D + +++TG +AF+AG Sbjct: 4 VVLTEIHGRVGLIRINRPEAMNALNNEVVDGIGAAIDAFEADENIGCIVITGNEKAFAAG 63 Query: 61 QDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAV 120 D+ D + R E + KP++ AV+G A G G +A+ D+ AA Sbjct: 64 ADIGFMKDFDYLHAYKTDFITRNWERIKTARKPVIAAVSGFALGGGCEMAMMCDMIFAAD 123 Query: 121 GASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAE 180 A F +R+G +P +G + LPR VG AKA ++ L + + A EA GLV R+ PA+ Sbjct: 124 TAKFGQPEIRLGTLPGAGGTQRLPRAVGKAKAMDMCLSARMMDAPEAEKAGLVARIYPAD 183 Query: 181 KLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGV 240 +L++E L A+ +A + K+ + + SL E L E + A +D +EG+ Sbjct: 184 QLLDETLKAAQTIAGFSLPVVMMIKESVNRAFESSLNEGLLFERRVFHAAFAVEDQKEGM 243 Query: 241 RAFREKRPPRFQGR 254 AF EKR P F+ R Sbjct: 244 AAFVEKRKPAFKHR 257 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory