Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_027456480.1 K420_RS0101415 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_000519045.1:WP_027456480.1 Length = 253 Score = 197 bits (502), Expect = 2e-55 Identities = 114/258 (44%), Positives = 166/258 (64%), Gaps = 10/258 (3%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 LL V+ L++ FGG+ AV +VSF+ ++G + ++IGPNGAGKTTLFN ITG Y PT G + L Sbjct: 3 LLEVKDLSIHFGGVKAVQNVSFNIDSGIVYSVIGPNGAGKTTLFNLITGVYKPTTGEIRL 62 Query: 71 RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIA 130 DG E + + P + VARTFQN+++ MS +EN++V H +L R + Sbjct: 63 ---DG-EAIHGKSPNE--LARRGVARTFQNLQICMNMSAIENVMVGAHLRLDRN---LVK 113 Query: 131 GLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVML 190 L PS + +R D A +D V L ++ + A + YGA +RLEIARA+ +P ++ Sbjct: 114 AALRFPSLKQRDRTLRDEAAQLMDFVGLAQYVETRADAMSYGALKRLEIARALAMKPRLI 173 Query: 191 CLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKISD 250 LDEPAAGLNP+E+ E+ L+ I D I V+L+EHDM +VM +SD ++VLDYG+K+++ Sbjct: 174 FLDEPAAGLNPKETIEVDHLVRKIADS-GITVVLVEHDMKMVMNLSDRILVLDYGKKLAE 232 Query: 251 GDPAFVKNDPAVIRAYLG 268 G ++ +P VI AYLG Sbjct: 233 GSGEEIRKNPDVIAAYLG 250 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 253 Length adjustment: 25 Effective length of query: 269 Effective length of database: 228 Effective search space: 61332 Effective search space used: 61332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory