Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_027456735.1 K420_RS0102920 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000519045.1:WP_027456735.1 Length = 276 Score = 191 bits (486), Expect = 1e-53 Identities = 108/240 (45%), Positives = 148/240 (61%), Gaps = 9/240 (3%) Query: 2 LSFDKVSTYYGK-IQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQA-----AS 55 LS + + Y I L VS+ V KG+IV L+GANGAGKST L + A Sbjct: 14 LSINNIEVIYDHVILVLKGVSLNVPKGKIVALLGANGAGKSTTLKAISNLLHAERGDVTK 73 Query: 56 GSIRYEGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQ--M 113 GS+ Y+G+ + L + ++++ + V EGR F LT+EENL G + Q++ + Sbjct: 74 GSVEYKGQRVDQLTPNELVKRGVIQVMEGRHCFGHLTIEENLLTGAYTRSISRSQLKENL 133 Query: 114 DKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIF 173 +KV FPRLK R +AG SGGEQQM AIGRALM+ P+++LLDEPS+GLAP I++++F Sbjct: 134 EKVYHYFPRLKTRRTSQAGYTSGGEQQMCAIGRALMANPEMVLLDEPSMGLAPQIVEEVF 193 Query: 174 EIIEQLR-REGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLG 232 EI++ L RE ++ L EQN ALK AD Y+LENGR+VM L TN V++ YLG Sbjct: 194 EIVKDLNSRENISFLLAEQNTMVALKYADFGYILENGRVVMEGDAEGLRTNEDVKEFYLG 253 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 276 Length adjustment: 24 Effective length of query: 209 Effective length of database: 252 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory