GapMind for catabolism of small carbon sources

 

Protein WP_024852023.1 in Hydrogenovibrio kuenenii DSM 12350

Annotation: NCBI__GCF_000526715.1:WP_024852023.1

Length: 255 amino acids

Source: GCF_000526715.1 in NCBI

Candidate for 31 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 94% 149.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 94% 149.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-glutamate catabolism gltL lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 39% 94% 149.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 39% 86% 145.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 38% 66% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 91% 144.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 36% 91% 144.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 59% 143.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 59% 143.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 59% 143.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 59% 143.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 59% 143.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 36% 59% 143.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 94% 141 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 38% 94% 141 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 93% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 93% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 93% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 93% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 93% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 36% 93% 136.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-arginine catabolism artP lo ABC transporter for L-Arginine, putative ATPase component (characterized) 37% 90% 136.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 38% 93% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 37% 91% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 93% 132.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 38% 90% 128.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 76% 125.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 36% 83% 124 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 57% 112.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 32% 58% 106.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 32% 71% 94.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 46% 194.5

Sequence Analysis Tools

View WP_024852023.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSDKTGEVMTADKSSVDAESPLLALSHINKIYRQGELQVDALTDIELTINKGEFAALVGP
SGSGKTTLLNIIGGLDRPSQGSVHLNGVDMTQLSESALSDFRLYQLGFIFQAYNLVPVLS
ALENVELIMVLQGIDEKERRERAEHYLGLVGLQDVLNRRPAALSGGQQQRVAVARALAAN
PTLVLADEPTANLDSENAFALLDIMHKLSHEEKTTFLFSTHDPRVMERAERIIRLRDGKI
EHDGNHNSGHKNPTM

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory