Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate WP_024852149.1 N745_RS0110835 ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >NCBI__GCF_000526715.1:WP_024852149.1 Length = 263 Score = 122 bits (305), Expect = 9e-33 Identities = 74/205 (36%), Positives = 121/205 (59%), Gaps = 12/205 (5%) Query: 16 VLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVIVDGTSIADPKTNLPKL 75 VLT+ + + KG++ + G SG GKSTL++ + L G V ++G ++ P Sbjct: 24 VLTNINLNIPKGQLTAMIGRSGCGKSTLLQMIAGLLLPSDGVVRINGKTVVKPS------ 77 Query: 76 RSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRSKEEASKKALQLLERVGLSAHAKKHPG 135 ++ M+FQ L+P +S+ +N + V + ++ + +LL+ VGLS H K+ Sbjct: 78 -AKWNMMFQKPSLYPWMSVRENAALGLV--FAGTYKQKQDRVEELLDMVGLSEHKDKNVQ 134 Query: 136 QLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLDVMVQLAHE-GMTMMCVTH 194 +LSGGQQQRVA+AR+LA +P ++L DEP SALD + + Q+ HE G+TM+ VTH Sbjct: 135 ELSGGQQQRVALARSLATEPEILLLDEPFSALDAFTRTALQTEVAQICHEQGITMIMVTH 194 Query: 195 EMGFARKVADRVIFM--DQGKIIED 217 ++ A +AD+V+ M + G+I+ D Sbjct: 195 DIEEAIAMADKVVIMSHNPGEIVGD 219 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 263 Length adjustment: 24 Effective length of query: 220 Effective length of database: 239 Effective search space: 52580 Effective search space used: 52580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory