Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_024850236.1 N745_RS0100765 heme ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000526715.1:WP_024850236.1 Length = 264 Score = 145 bits (366), Expect = 8e-40 Identities = 96/264 (36%), Positives = 144/264 (54%), Gaps = 18/264 (6%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L+ +L ++ + +LN VS+ L ++ A++GPNG GKSTLL C S L P SG V + Sbjct: 2 LKAIDLKLTLESKTILNSVSIELQPRQLIAVLGPNGAGKSTLLKCLSGELSPHSGEVLMD 61 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 +P+++LS+ LA R +++PQ TV E+V G+ LS S E V + Sbjct: 62 SDPLHVLSTETLALRRAVMPQSVQLDFPFTVTEVVEMGQRYALS-----SIELQQMVEQS 116 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQ---------NTP-VVLLDEPTTYLDIN 172 ++ + HL R LSGG++QR LA V+ Q P +LLDE T+ LD++ Sbjct: 117 LSMFDVQHLKTRNYLTLSGGEQQRVQLARVVGQLLSAMQFQKTVPGYLLLDECTSSLDLS 176 Query: 173 HQVDLMRLMGELRT-QGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLL 231 HQ + ++ +L G V+ VLHDLN AS+Y DQLV+M G V QG+P EV+ ++ Sbjct: 177 HQHLVFKVARQLADHHGMGVLMVLHDLNLASQYADQLVLMKQGQVHYQGSPLEVLNEEIV 236 Query: 232 RTVFSVEAEIHP--EPVSGRPMCL 253 ++ + P E VS P+ L Sbjct: 237 EAIYDFSVRVLPPTEGVSDWPLVL 260 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 264 Length adjustment: 24 Effective length of query: 231 Effective length of database: 240 Effective search space: 55440 Effective search space used: 55440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory