Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate WP_024850637.1 N745_RS0102890 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >NCBI__GCF_000526715.1:WP_024850637.1 Length = 311 Score = 176 bits (446), Expect = 8e-49 Identities = 101/241 (41%), Positives = 146/241 (60%), Gaps = 10/241 (4%) Query: 3 NLKIKNLQKGFEGFS----IIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGG 58 +L++K L K FE ++ GID V +EF+ VGPSGCGKSTL RLI+GLE+ G Sbjct: 35 SLELKELHKSFEHKGNVNKVLDGIDFSVFKREFICVVGPSGCGKSTLARLISGLEQKESG 94 Query: 59 TIELDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKKVSEAA 118 I +DG+D+ E P D MVFQ Y+L+P MSV++N+ F L +G+AK+ E + + Sbjct: 95 QILVDGQDVVEPGP---DRGMVFQGYSLFPWMSVKQNVMFGLTESGMAKSTAETEALQWI 151 Query: 119 RILELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELLR 178 ++ L + P QLSGG +QRVAI RA+ PKI L DEP + LD R++M+ LL Sbjct: 152 DLVGLSKFADAYPHQLSGGMKQRVAIVRALANQPKILLMDEPFAALDPKNRLKMQQYLLE 211 Query: 179 LHKELQATMIYVTHDQVEAMTMADKVVVL--NGGKI-EQVGSPLDLYHQPANLFVAGFLG 235 + + + T+ ++THD EA+ +AD+++VL N G++ E V PL + L FL Sbjct: 212 IWRNIDITIFFITHDLDEAIYLADRILVLDANPGRVREVVKVPLPRPREDDTLLSPAFLA 271 Query: 236 T 236 T Sbjct: 272 T 272 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 311 Length adjustment: 28 Effective length of query: 339 Effective length of database: 283 Effective search space: 95937 Effective search space used: 95937 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory