Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_024851725.1 N745_RS0108650 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00010 (365 letters) >NCBI__GCF_000526715.1:WP_024851725.1 Length = 282 Score = 153 bits (386), Expect = 6e-42 Identities = 95/215 (44%), Positives = 131/215 (60%), Gaps = 14/215 (6%) Query: 10 KKGFEGLSIIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSGTIELDGRDITE 69 KKG + +++ IDL VK+ EFV VG SGCGKSTLLR+I GLE +T G + +D + + Sbjct: 17 KKG--AVEVLESIDLTVKENEFVALVGASGCGKSTLLRIIGGLEKLTKGQVLVDEEIVNK 74 Query: 70 VTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLA----GEKKPDVERKVAEAARILELGS 125 P K D AMVFQ Y+LYP +TV++N+ F+ +L G D+ V + +L+L Sbjct: 75 --PGK-DRAMVFQDYSLYPWLTVKENIQFSRNLKINGQGNGLGDIGSMVDRSYALLDLMG 131 Query: 126 L---LDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSRLHKE 182 L D P QLSGG RQRVAI RA++ P + L DEP LDA R + L + Sbjct: 132 LEKVQDSHPNQLSGGMRQRVAIARALMSKPDVLLMDEPFGALDAQTREVMHDLILHLFEI 191 Query: 183 LQATMIYVTHDQVEAMTLATKVVVL--NAGRIEQI 215 ++T+++VTHD EA+ LA +VVV+ N GRI+ I Sbjct: 192 EKSTIVFVTHDVEEAIYLADRVVVMAPNPGRIDSI 226 Lambda K H 0.319 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 282 Length adjustment: 28 Effective length of query: 337 Effective length of database: 254 Effective search space: 85598 Effective search space used: 85598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory