Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_024851414.1 N745_RS0107015 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000526715.1:WP_024851414.1 Length = 264 Score = 140 bits (353), Expect = 4e-38 Identities = 78/229 (34%), Positives = 132/229 (57%), Gaps = 12/229 (5%) Query: 4 LKLDNIYKRYPNAK--HYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGN 61 L+L N+ +P K +++ NL I EFI +G SGCGKST + ++AGL + TEG Sbjct: 6 LELTNVGIEFPTPKGAFRALQGVNLKIEQGEFISLIGHSGCGKSTVMNIVAGLYEATEGG 65 Query: 62 LYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGL-KLRKYKKDDINKR--VHE 118 + +D K +N P+ A+VFQN++L P ++ YEN+ + ++ K K K+ + Sbjct: 66 VLLDGKEVNSPGPER---AVVFQNHSLLPWLTAYENVELAVDQVFKRSKSSAEKKEWIEH 122 Query: 119 AAEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEI 178 +++ + + ++P ++SGG +QRV + RA+ K+ LMDEP LDA R ++ + Sbjct: 123 NLKLVHMDHAMHKRPDEISGGMKQRVGIARALAMQPKIMLMDEPFGALDALTRAHLQDSL 182 Query: 179 AKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQI 227 +I + + T I +THD EA+ L+DRI++M+ P +IG I ++ Sbjct: 183 MEIQKDLNNTVIMITHDVDEAVLLSDRIIMMTNGP----AATIGEILKV 227 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 264 Length adjustment: 27 Effective length of query: 350 Effective length of database: 237 Effective search space: 82950 Effective search space used: 82950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory