Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_024851414.1 N745_RS0107015 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000526715.1:WP_024851414.1 Length = 264 Score = 143 bits (361), Expect = 5e-39 Identities = 77/214 (35%), Positives = 127/214 (59%), Gaps = 8/214 (3%) Query: 4 LELRNVNKTYGA--GLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGGA 61 LEL NV + G L+ + L I++GEF+ L+G SGCGKST+MN +AGL T G Sbjct: 6 LELTNVGIEFPTPKGAFRALQGVNLKIEQGEFISLIGHSGCGKSTVMNIVAGLYEATEGG 65 Query: 62 IMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKI---RKMPQADIDAEVAR 118 +++ ++V+ P+ A+VFQ+++L P ++ EN+E + R A+ + Sbjct: 66 VLLDGKEVNSPGPER---AVVFQNHSLLPWLTAYENVELAVDQVFKRSKSSAEKKEWIEH 122 Query: 119 VAKLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEM 178 KL+ ++H ++++P ++SGG +QRV + RALA +PKI L DEP LDA R ++ + Sbjct: 123 NLKLVHMDHAMHKRPDEISGGMKQRVGIARALAMQPKIMLMDEPFGALDALTRAHLQDSL 182 Query: 179 KLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDG 212 + + L T + +THD EA+ L D++ +M +G Sbjct: 183 MEIQKDLNNTVIMITHDVDEAVLLSDRIIMMTNG 216 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 264 Length adjustment: 27 Effective length of query: 359 Effective length of database: 237 Effective search space: 85083 Effective search space used: 85083 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory