GapMind for catabolism of small carbon sources

 

Protein WP_025272421.1 in Haloglycomyces albus DSM 45210

Annotation: NCBI__GCF_000527155.1:WP_025272421.1

Length: 503 amino acids

Source: GCF_000527155.1 in NCBI

Candidate for 35 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-fructose catabolism fruK hi Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized) 53% 97% 512.3 galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) 51% 478.0
sucrose catabolism fruK hi Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized) 53% 97% 512.3 galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) 51% 478.0
D-galactose catabolism ytfR med galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized) 51% 98% 478 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-arabinose catabolism araVsh med ABC transporter related (characterized, see rationale) 49% 100% 462.2 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-cellobiose catabolism mglA med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-glucose catabolism mglA med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
lactose catabolism mglA med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-maltose catabolism mglA med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
sucrose catabolism mglA med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
trehalose catabolism mglA med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-xylose catabolism xylG med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 42% 100% 394 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-fucose catabolism HSERO_RS05250 med Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) 41% 94% 370.9 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-mannose catabolism HSERO_RS03640 med Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) 41% 93% 369 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
myo-inositol catabolism iatA med Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 40% 97% 347.8 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-ribose catabolism rbsA lo Ribose import ATP-binding protein RbsA 2, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized) 39% 95% 360.9 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-xylose catabolism xylK_Tm lo Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale) 38% 96% 351.3 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
myo-inositol catabolism PS417_11890 lo Inositol transport system ATP-binding protein (characterized) 39% 95% 349.4 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-fructose catabolism frcA lo ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 40% 95% 344.7 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
sucrose catabolism frcA lo ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 40% 95% 344.7 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-galactose catabolism BPHYT_RS16930 lo Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale) 40% 91% 337.4 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-galactose catabolism mglA lo Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 37% 96% 330.5 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-rhamnose catabolism rhaT' lo RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized) 37% 92% 330.5 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
xylitol catabolism PS417_12065 lo D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale) 36% 97% 316.6 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-arabinose catabolism araG lo L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized) 36% 93% 310.1 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-arabinose catabolism gguA lo GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized) 35% 99% 306.6 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-galactose catabolism gguA lo GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized) 35% 99% 306.6 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
2'-deoxyinosine catabolism H281DRAFT_01113 lo deoxynucleoside transporter, ATPase component (characterized) 35% 95% 290.8 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
2'-deoxyinosine catabolism nupA lo RnsB, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized) 35% 97% 283.5 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-fucose catabolism BPHYT_RS34245 lo ABC transporter related; Flags: Precursor (characterized, see rationale) 36% 92% 264.2 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-rhamnose catabolism BPHYT_RS34245 lo ABC transporter related; Flags: Precursor (characterized, see rationale) 36% 92% 264.2 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 37% 94% 165.2 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 40% 95% 156 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 36% 95% 149.4 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 36% 95% 149.4 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 30% 98% 126.3 Fructose import ATP-binding protein FruK; EC 7.5.2.- 53% 512.3

Sequence Analysis Tools

View WP_025272421.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSTVIQMRGIRKSFPGVDALKGVDLTLRKGEIHAVMGENGAGKSTLIKTLTGVHRHDAGK
ILLHDKPVTFKSPGEAQNAGIATVYQEVNLTDNLSVAENLFAGREKRFGPFINFRDMRRQ
ARQVLRDLGLDLDVTAPLSHYSLAMQQLVAIARAVTMEAQVLVLDEPTSSLDKDEVKLLL
KVMRALADQGVSLVFISHFLDQVYDVCDRMTVLRGGELIGEWGTSELSQYELIEHMLGRE
VSDLASLSVEGRNDEVGPEAVVAADNLGRTGSIEPFDLEVKKGEIVGLAGLLGAGRTEAA
RLITGADHADNGQLSVHGKKQNGYGPRDAIAQGVAYCSEDRKGEGLIPDLTVAENIVIAL
QAARGWVRRIPAAERDRVVRNYIEKLDIRPSDPDMPVRNLSGGNQQKVILARWLLMDPRL
LVLDEPTRGIDVGAKADIQRLVTELSADGMGVVFISAELEEVVRLSHRIAVLKDHKMIDT
FRNTADTTTDDIVDTIAAGGRPC

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory