Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_025272362.1 HALAL_RS0101795 3-oxoacyl-ACP reductase FabG
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >NCBI__GCF_000527155.1:WP_025272362.1 Length = 236 Score = 113 bits (283), Expect = 3e-30 Identities = 78/243 (32%), Positives = 123/243 (50%), Gaps = 14/243 (5%) Query: 23 VVLLTGAAQGIGEAIVAAFASQQARLVISDIQAQKVEAVAAHWRERGADVHALQADVSKQ 82 VVL+TG +GIG A A+Q+ + D V + + E DVH Q DVS Sbjct: 5 VVLITGGTRGIGRA-----AAQRLK---DDGFTVAVASRSIPDAENRLDVHHYQVDVSDG 56 Query: 83 QDLQAMARRAVELHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGCKAVLP 142 + + + G IDVL+N AG+ L MT +DW +LDG + C+++ Sbjct: 57 NACKDLITTVEDEVGDIDVLINSAGIVRDSPLLTMTGDDWNDVIRTNLDGTYNMCRSMAF 116 Query: 143 QMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAPGY 202 M+++ GSIIN++SV P Y +K G++G ++AL E +RVN +APG+ Sbjct: 117 SMMKRKNGSIINLSSVAGIQGNPTQSNYSASKAGIIGFSKALSKELGRFNIRVNVVAPGF 176 Query: 203 IETQLNVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVFLASDEAPFINASCITI 262 IET + D + +++A++ P R+G +VA FLAS A ++ + + + Sbjct: 177 IETDMTADL------AESVKKKAVENIPLGRMGSVDDVAHLVGFLASPRATYMTGAVVPV 230 Query: 263 DGG 265 DGG Sbjct: 231 DGG 233 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 236 Length adjustment: 24 Effective length of query: 248 Effective length of database: 212 Effective search space: 52576 Effective search space used: 52576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory