Align AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_025272538.1 HALAL_RS0102760 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52815 (257 letters) >NCBI__GCF_000527155.1:WP_025272538.1 Length = 247 Score = 255 bits (652), Expect = 5e-73 Identities = 124/239 (51%), Positives = 179/239 (74%) Query: 18 VEIVNMNKWYGDFHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCINRLEEHQKGKIVVD 77 V+I +++K +G VL+ I+L + GE + I GPSGSGKST++RC+N LE +G+IVVD Sbjct: 6 VDIQSLHKQFGKLKVLQGIDLTIESGEVVCIIGPSGSGKSTLLRCVNLLEPPTEGRIVVD 65 Query: 78 GTELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKQAEEVAMHFL 137 +LT+ +D R+++GMVFQHFNLFPH+ +L N T+A V + + +AE+VAM L Sbjct: 66 DFDLTHPDANLDLARQQIGMVFQHFNLFPHMNVLRNVTIAQEKVLRRNRDKAEQVAMEQL 125 Query: 138 KRVKIPEQANKYPGQLSGGQQQRVAIARSLCMNPKIMLFDEPTSALDPEMIKEVLDTMVG 197 ++V + ++A+ +P +LSGGQQQRVAIAR+L MNP +MLFDEPTSALDPE++ +VL M Sbjct: 126 EKVGVADKADVFPSKLSGGQQQRVAIARALAMNPDLMLFDEPTSALDPELVGDVLTVMRR 185 Query: 198 LAEEGMTMLCVTHEMGFARQVANRVIFMDQGQIVEQNEPAAFFDNPQHERTKLFLSQIL 256 LA++GMTM+ VTHEM FA++VA+RV+FMD+G+IVE+ P + P +R + FLS++L Sbjct: 186 LADDGMTMIVVTHEMTFAKEVADRVVFMDEGRIVEEGNPLDVLERPSTQRARDFLSRVL 244 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 247 Length adjustment: 24 Effective length of query: 233 Effective length of database: 223 Effective search space: 51959 Effective search space used: 51959 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory