Align ATPase (characterized, see rationale)
to candidate WP_025272462.1 HALAL_RS0102355 methionine ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000527155.1:WP_025272462.1 Length = 252 Score = 165 bits (417), Expect = 1e-45 Identities = 99/246 (40%), Positives = 149/246 (60%), Gaps = 7/246 (2%) Query: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 MI V K +G+ AL G+ LT++RGEV ++G SG+GKST LR LN L G I Sbjct: 1 MITLTNVTKRFGD-VTALDGIDLTIERGEVFGILGRSGAGKSTLLRCLNRLAVPDSGTIA 59 Query: 81 IEGHRLSHDR-RDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATAR 139 ++G L+ + R + RQ M+FQ FNL + + N+ L P+++ + + A Sbjct: 60 VDGVDLAELKPRSLRRQRQSSAMIFQHFNLLSNRNAVSNVAL-PLRLNGTKRTERKKRAL 118 Query: 140 QLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDV 199 +LLERV +A++A YPGQLSGGQ+QR+AIARALA P +LL DE TSALD + E+L++ Sbjct: 119 ELLERVDLADKARAYPGQLSGGQRQRLAIARALATNPDVLLSDEATSALDTDTTDEILEL 178 Query: 200 MRDLASE-GMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQS---DRAKQ 255 ++ L + G+T+++ THE+G ++ R +M +G I+E DR P + A+Q Sbjct: 179 LKQLNRDLGLTIVLITHELGVIAQICHRAAVMEEGAIIETGEVDRLLADPDTRLGSNARQ 238 Query: 256 FLAQIL 261 A++L Sbjct: 239 AAARLL 244 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 252 Length adjustment: 24 Effective length of query: 237 Effective length of database: 228 Effective search space: 54036 Effective search space used: 54036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory