Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_025274425.1 HALAL_RS0113050 3-oxoacyl-ACP reductase FabG
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >NCBI__GCF_000527155.1:WP_025274425.1 Length = 234 Score = 114 bits (286), Expect = 1e-30 Identities = 76/242 (31%), Positives = 116/242 (47%), Gaps = 13/242 (5%) Query: 23 VDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKPLFLSCDL 82 + RTVL+TGG GIG + F G RVA + A E L + CD+ Sbjct: 1 MSRTVLVTGGNRGIGLAIARAFEKNGDRVAVTHRGSGAPEGLYG-----------VQCDI 49 Query: 83 TDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRESFDAGIAVNIRHQFFAAQA 142 TD D++ A ++A LGP++VLV NA + ++ E F+ + N+ + A+ Sbjct: 50 TDSDSVNAAFEQIEADLGPVEVLVANAGVTDDTLLLRMSEEQFENVLNTNLTGAWRCAKR 109 Query: 143 VMEDMKAANSGSIINLGSISWMLKNGGYPVYVMSKSAVQGLTRGLARDLGHFNIRVNTLV 202 M A G +I + S+ ML N G Y SK+ + GL R + R+LG NI N + Sbjct: 110 ASSKMLRAKFGRMIFISSVVGMLGNAGQTNYAASKAGLVGLARSITRELGSRNITANVIA 169 Query: 203 PGWVMTEKQKRLWLDDAGRRSIKEGQCIDAELEPADLARMALFLAADDSRMITAQDIVVD 262 PG+V T+ L D R++ + +P ++A A +L+ +D+ I I VD Sbjct: 170 PGFVETDMTAE--LSDDQRKAYLDTIPAKRLAQPEEIAATATWLSGNDAGYINGAIIPVD 227 Query: 263 GG 264 GG Sbjct: 228 GG 229 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 234 Length adjustment: 24 Effective length of query: 242 Effective length of database: 210 Effective search space: 50820 Effective search space used: 50820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory