Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; L-KDR 4-dehydrogenase; EC 1.1.1.401 (characterized)
to candidate WP_025272126.1 HALAL_RS0100575 SDR family NAD(P)-dependent oxidoreductase
Query= SwissProt::Q1NEI6 (249 letters) >NCBI__GCF_000527155.1:WP_025272126.1 Length = 290 Score = 119 bits (298), Expect = 7e-32 Identities = 88/246 (35%), Positives = 125/246 (50%), Gaps = 18/246 (7%) Query: 10 GRCAIVTGGAS--GLGKQVAARIIAEGGAVALWDLNGDALAATQAEIDATHVVALDVSDH 67 G+ A+VTG + G+G +A R+ G +AL + E+DA VA D++D Sbjct: 48 GKTALVTGAGADDGIGMAIATRLRLAGARLALVSTT-KRIHERANELDAVGFVA-DLTDE 105 Query: 68 AAVAAAAKDSAAALGKVDILICSAGITGATVPVWEFPV-----DSFQRVIDINLNGLFYC 122 A VA LG+VDI++ +AG+T T P PV D ++ I NL+ F Sbjct: 106 AEVAGLGDAVTEGLGEVDIVVNNAGMTSKTAPAVTKPVAQLGFDDWEAEITRNLHSTFLV 165 Query: 123 NREVVPFMLENGYGRIVNLASVAGKEG-NPNASAYSASKAGVIGFTKSLGKELAGKGVIA 181 +R V M E+G+GRIVN+++ AG P +AY+++KAGV G T++L E+ GV Sbjct: 166 SRYFVQSMAESGWGRIVNVSATAGVSSVMPAEAAYASAKAGVAGLTRALATEVVADGVTV 225 Query: 182 NALTPATFE--SPILDQLPQSQVDYMRSKIPMGRLGLVEESAAMVCFMASEECSFTTAST 239 NA+ P S + +L Q VD P+GR G EE AA V F S S+ T T Sbjct: 226 NAVAPGLIHTGSSTVPEL-QRGVD-----SPLGRPGTPEEVAAAVAFFCSPSASYVTGQT 279 Query: 240 FDTSGG 245 GG Sbjct: 280 LVVDGG 285 Lambda K H 0.318 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 290 Length adjustment: 25 Effective length of query: 224 Effective length of database: 265 Effective search space: 59360 Effective search space used: 59360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory