Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_025272126.1 HALAL_RS0100575 SDR family NAD(P)-dependent oxidoreductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000527155.1:WP_025272126.1 Length = 290 Score = 139 bits (350), Expect = 7e-38 Identities = 105/257 (40%), Positives = 138/257 (53%), Gaps = 30/257 (11%) Query: 12 DLFRLDGRHALVTGGA--QGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFERL 69 DL L G+ ALVTG GIG IA L AGAR+ + + E A ELD Sbjct: 42 DLDSLIGKTALVTGAGADDGIGMAIATRLRLAGARLALVSTTKRIHE-RANELDAVGFVA 100 Query: 70 NVTDADAVADLA----RRLPDVDVLVNNAGIV-RNAPAEDTPD-----DDWRAVLSVNLD 119 ++TD VA L L +VD++VNNAG+ + APA P DDW A ++ NL Sbjct: 101 DLTDEAEVAGLGDAVTEGLGEVDIVVNNAGMTSKTAPAVTKPVAQLGFDDWEAEITRNLH 160 Query: 120 GVFWCCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWA 179 F R F ++M G G IV+ ++ +G+ S P +AAY ++KA V LTR+LA E Sbjct: 161 STFLVSRYFVQSMAESGWGRIVNVSATAGVSSVMPA-EAAYASAKAGVAGLTRALATEVV 219 Query: 180 SRGVRVNAVAPGYTAT-----PLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLA 234 + GV VNAVAPG T P +RG+++P LGR P E+A AV + Sbjct: 220 ADGVTVNAVAPGLIHTGSSTVPELQRGVDSP-----------LGRPGTPEEVAAAVAFFC 268 Query: 235 SDAASFVTGHTLVVDGG 251 S +AS+VTG TLVVDGG Sbjct: 269 SPSASYVTGQTLVVDGG 285 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 290 Length adjustment: 25 Effective length of query: 230 Effective length of database: 265 Effective search space: 60950 Effective search space used: 60950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory