Align small component of L-lactate and L-malate uptake system (characterized)
to candidate WP_028488409.1 Q394_RS0105610 DUF4212 domain-containing protein
Query= reanno::PV4:5209924 (88 letters) >NCBI__GCF_000621325.1:WP_028488409.1 Length = 84 Score = 98.2 bits (243), Expect = 2e-26 Identities = 44/82 (53%), Positives = 60/82 (73%) Query: 6 NEKAEGYWRENLRLVLGLLAIWAAVSFGCGILLVDVLNEIHFMGFKLGFWFAQQGAMYVF 65 ++ A+ YW N+RL+ LAIW VSFG GILL+D LN IH G+KLGFWFAQQG++YVF Sbjct: 3 DKSAKAYWAANVRLLTICLAIWFIVSFGFGILLLDQLNTIHLGGYKLGFWFAQQGSIYVF 62 Query: 66 VALIFVYVAKANALDKKYNVHE 87 + LI Y + +D++++VHE Sbjct: 63 IGLITFYAWRMGQIDREFDVHE 84 Lambda K H 0.329 0.143 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 64 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 88 Length of database: 84 Length adjustment: 9 Effective length of query: 79 Effective length of database: 75 Effective search space: 5925 Effective search space used: 5925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (20.8 bits) S2: 38 (19.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory