Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_028488909.1 Q394_RS0108480 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= TCDB::Q9HU32 (257 letters) >NCBI__GCF_000621325.1:WP_028488909.1 Length = 369 Score = 150 bits (379), Expect = 4e-41 Identities = 86/250 (34%), Positives = 147/250 (58%), Gaps = 17/250 (6%) Query: 5 TPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQI 64 +P L + N+ KR+ EVL +LT +DG+ +ILG SG GK+T LR I E P++GQI Sbjct: 4 SPILTLSNISKRFASQEVLSDFNLTIQDGEFFTILGPSGCGKTTVLRLIAGFEQPNEGQI 63 Query: 65 LVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLG 124 L++G+++ + A+ + N VFQ++ L+PH+++ DNV + Sbjct: 64 LLNGDDIA--------RIPAEKRPFNT-------VFQSYALFPHLTVFDNVAFGLKMAGV 108 Query: 125 KSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSAL 184 + A+ +A+ LA V +++ P QLSGGQ+QR AIAR + +PK++L DE SAL Sbjct: 109 DVQDIAVRVADA-LAIVRLSEFATRKPHQLSGGQKQRVAIARAVVNRPKILLLDESLSAL 167 Query: 185 DPEMVQEVLNVIRALAEE-GRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFEN 243 D ++ Q++ ++ L + G T + VTH+ A +S ++ +H G ++ GTP++++E+ Sbjct: 168 DYKLRQQMQLELKQLQRQLGITFVYVTHDQEEALSMSDRILVMHNGQAQQVGTPREIYES 227 Query: 244 PQSARCKQFM 253 P++ QF+ Sbjct: 228 PRNLFVAQFI 237 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 369 Length adjustment: 27 Effective length of query: 230 Effective length of database: 342 Effective search space: 78660 Effective search space used: 78660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory