Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_028489816.1 Q394_RS0113995 aspartate aminotransferase family protein
Query= curated2:Q89RB7 (404 letters) >NCBI__GCF_000621325.1:WP_028489816.1 Length = 397 Score = 266 bits (679), Expect = 1e-75 Identities = 156/387 (40%), Positives = 222/387 (57%), Gaps = 11/387 (2%) Query: 20 YEPIGVVLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHRLTLTSRA 79 Y + V ++GEG ++WDT G +YLD LS S + GH ++ A+ QAH L TS Sbjct: 9 YARLPVTFAKGEGAFLWDTAGKQYLDALSGISVCNVGHARREVADAICAQAHELLHTSNL 68 Query: 80 FHNDQLAPFYEEIAALTGSHKVLPMNSGAEAVESAIKSVRKWGYEVKGVPDDQAEIIVCA 139 + + E++ AL+G V NSGAEA E+AIK R +G+ KGV + ++V + Sbjct: 69 YQIEHQQALAEKLCALSGFENVFFGNSGAEANEAAIKIARLYGHN-KGV--EIPTVVVMS 125 Query: 140 DNFHGRTLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQ-AITPNTVAFLVEPIQG 198 + FHGRT+ V + +P+ + FGP GF + +GDA A+ PN VA LVEP+QG Sbjct: 126 NAFHGRTMATVTATGNPKAQAGFGPLVEGFVRVEYGDADAVAALGSNPNIVAVLVEPVQG 185 Query: 199 EAGVIIPPAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEGIEADVTLLGKAL 258 E G+ IP Y ++R +C ++ +L++DEIQ+G+ RTGK A QH GI+ DV L KAL Sbjct: 186 EGGIRIPADDYLPRLRAICDQHDWLLMVDEIQSGMARTGKWFAFQHSGIQPDVMTLAKAL 245 Query: 259 AGGFYPVSAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVEEGMIENAARQGA 318 G P+ A L+ + PG HGSTFGGNPLAC ARA + V+ +E + AA G Sbjct: 246 GNG-VPIGACLAGGKAANVFGPGNHGSTFGGNPLACRAARAVIGVMEQENLPARAAELGE 304 Query: 319 RLLEGLKDIRANT--VREVRGRGLMLAVELHPEAGRARRYCEALQGKGILAKDTHGHTIR 376 L + A VRE+R +GLM+ VEL + G + +AL+ G+L T G+ IR Sbjct: 305 YFLSQFRAKLAGETGVREIRVKGLMVGVELERDCGELVK--QALE-SGLLLNVTAGNVIR 361 Query: 377 IAPPLVITSDEVDWALEQFATTLTQDF 403 + PPL+IT ++ D + T L Q F Sbjct: 362 LLPPLIITHEQADHII-TMVTALVQAF 387 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 397 Length adjustment: 31 Effective length of query: 373 Effective length of database: 366 Effective search space: 136518 Effective search space used: 136518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory