Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_038140451.1 Q394_RS0103825 ABC transporter permease subunit
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_000621325.1:WP_038140451.1 Length = 317 Score = 93.6 bits (231), Expect = 4e-24 Identities = 68/242 (28%), Positives = 112/242 (46%), Gaps = 42/242 (17%) Query: 14 MQGLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFRNTPLLL----WM 69 + GL TLK+A+ I++ + G L + + + L + L Y+++FRN PLLL W Sbjct: 75 LAGLGNTLKVAVVGIILTTILGVLLGVGRFSHNILIRGLCLTYVEVFRNVPLLLQLLMWY 134 Query: 70 LAACFVLP--------------------VFFGQFP---------------QAFWGTIGFS 94 L LP +FG P + F +G + Sbjct: 135 LVCVEWLPNVREAEPFLGIYLTKAGLALPWFGDMPVKAGFGIKGGVNLSPEFFALLLGLT 194 Query: 95 LYTSSVMAEIIRGGLNSIPKGQFEAAYSQGFGKFFTLFYIILPQTFRKIIPALLSQIVTT 154 +YT+S +AEI+R G+ S+P+GQ EAA + G + T+ I LPQ R IIP L +Q + Sbjct: 195 IYTASYIAEIVRSGIASVPRGQREAALALGLSRGQTMRLIQLPQALRVIIPPLTNQYLNL 254 Query: 155 VKDTAYLAGLGIAELTYNSKTILAKLTSFEEILAMIGVVAGIYFIICFSLSMLVRYYAKK 214 K+++ +G EL + T L + E +A V+ +Y + S + +Y ++ Sbjct: 255 TKNSSLAVAVGYPELVSIANTSLNQTGRAVECIA---VIMAVYLTLSLLTSAFMGWYNRR 311 Query: 215 TA 216 +A Sbjct: 312 SA 313 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 219 Length of database: 317 Length adjustment: 25 Effective length of query: 194 Effective length of database: 292 Effective search space: 56648 Effective search space used: 56648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory