Align Extracellular solute-binding protein, family 3 (characterized, see rationale)
to candidate WP_028488110.1 Q394_RS0103820 amino acid ABC transporter substrate-binding protein
Query= uniprot:Q31RP1 (359 letters) >NCBI__GCF_000621325.1:WP_028488110.1 Length = 343 Score = 317 bits (811), Expect = 4e-91 Identities = 151/315 (47%), Positives = 215/315 (68%), Gaps = 2/315 (0%) Query: 45 LNQVQARGKLLCGVEGRLPGFSFLDSQGNYSGLDVDICKAIAAALFNDPKAIEYRSLDSV 104 L+ +++R +L+CGV L GFS DS+G +SG+DVD CKA+AA++ D ++Y L++ Sbjct: 31 LDTIKSRDQLVCGVNVALAGFSSTDSEGKWSGMDVDYCKALAASILGDANKVKYVPLNAQ 90 Query: 105 ERFPALASGEVDLLSRNTTWTLSRDAKGGNNLEFAPTTFYDGQGLMVRRNSGIQSLQDFQ 164 +RF AL SGE+D+LSRNTTWTL+RDA G N F +YDGQG MV++ I S ++ Sbjct: 91 QRFTALQSGEIDILSRNTTWTLTRDASLGAN--FVGVMYYDGQGFMVKKELKIASAKELN 148 Query: 165 GKSICVETGTTSELNLADTMRELGVQYQEIKFPNSDANYAAYAQGRCEGVTSDRSQLAAR 224 G ++C ++GTT+E NL+D R + + + F ++A AY GRC+ T+D S LAA Sbjct: 149 GATVCTQSGTTTEKNLSDFARANKLDIKPLVFEKNEAATGAYQSGRCQAYTTDASGLAAE 208 Query: 225 RTTLSDADQHQLLDAVISKEPLSPATLNNDSPWFDVVKWVVNATIQAEEFGITQANIDQF 284 R+ D+H +L +ISKEPL P D +F + KWV+NA ++ EE+G+TQAN+D+ Sbjct: 209 RSISKTPDEHMILPEIISKEPLGPLVRRGDDEFFAISKWVLNALLEGEEYGLTQANLDEK 268 Query: 285 KTSKNPEIRRFLGLEGELGQQLGLSNDFAYRAIKAVGNYGEIYERNVGQQSPLKLNRGLN 344 K+S +P I+R LG +G LGL ++AYRA+KA GNYGEI+ERNVG+ SPLKL RGLN Sbjct: 269 KSSDDPNIQRILGTSENMGTLLGLDKEWAYRALKATGNYGEIFERNVGKDSPLKLERGLN 328 Query: 345 QLYKNGGLLYSPPFR 359 Q + GG++Y+PP R Sbjct: 329 QPWNKGGIMYAPPIR 343 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 343 Length adjustment: 29 Effective length of query: 330 Effective length of database: 314 Effective search space: 103620 Effective search space used: 103620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory