Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_028488458.1 Q394_RS0105895 dipeptide ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_000621325.1:WP_028488458.1 Length = 570 Score = 169 bits (428), Expect = 2e-46 Identities = 96/261 (36%), Positives = 157/261 (60%), Gaps = 8/261 (3%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPG 104 +LEV NL + G R +KAV+DVSF + KGE ++GESGSGK+ +++R + P Sbjct: 5 LLEVRNLRTYLNSGG-RTVKAVDDVSFSIPKGETFCLVGESGSGKSISALSVIRLL--PQ 61 Query: 105 KIIS---GKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISE-IFYHEAI 160 I S G+++FNG DI + D R + I+ + Q +LNPV + E I + Sbjct: 62 GIASHPGGEILFNGQDILKLPEDALRGIRGSQIAMIFQEPMTSLNPVFSVGEQITEALQL 121 Query: 161 SHGEADKKRVIERASELLKLVGLDPARV-LKMYPFQLSGGMKQRVMIALSLLLNPKLILM 219 H + +ERA L+ V + AR + YP QLSGG +QRVMIA++L P L++ Sbjct: 122 HHPTMSDEEALERALLALEQVQIPKARERFRDYPHQLSGGQRQRVMIAMALACEPDLLIA 181 Query: 220 DEPTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGK 279 DEPT+ALD+ Q +L+L++ + + G++ +++THD +AQ+A ++ VM +G ++E G Sbjct: 182 DEPTTALDVTVQAEILRLLRQLQDDTGMSTLFITHDFGVVAQMAQQVGVMQQGKLVEVGS 241 Query: 280 TEEIIKSPLNPYTSLLVSSIP 300 T ++++ P + YT L++++P Sbjct: 242 TAQVLRHPQHAYTQQLLAAVP 262 Score = 154 bits (390), Expect = 4e-42 Identities = 93/265 (35%), Positives = 157/265 (59%), Gaps = 13/265 (4%) Query: 45 ILEVHNLNVIYDEGNSRI------IKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILR 98 +L + NLNV + + ++AV+DVS + KG+I+ ++GESG GKTTL A+L+ Sbjct: 309 LLSIRNLNVWFPIKKGLLRRTVDHVRAVDDVSLDIPKGQIVALVGESGCGKTTLGRAVLQ 368 Query: 99 AIRPPGKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHE 158 +P SG + +G ++ ++ E R L K + Q Q++LNP L + Sbjct: 369 LEKPT----SGSIQLHGQELTGLSARELRPLRPK-MQIAFQDPQSSLNPRLLVETTLTEP 423 Query: 159 AISHG-EADKKRVIERASELLKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLI 217 +HG +++ IERA+++L + L P L YP + SGG +QR+ +A +L+LNP+ I Sbjct: 424 LKAHGIGVNQEERIERAAQILDDMQL-PRDALWRYPHEFSGGQRQRIGLARALVLNPEFI 482 Query: 218 LMDEPTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEE 277 + DE TSALD+ Q +L+L+ I E +T++++TH+I + ++++ +VMYKG ++E Sbjct: 483 VCDEITSALDVSVQAEILQLLLKIRDEHNLTLLFITHNIGVVEYLSDQTMVMYKGKIVER 542 Query: 278 GKTEEIIKSPLNPYTSLLVSSIPSL 302 G T E+ +P YT L+S++P L Sbjct: 543 GATAEVCGNPQEDYTQKLLSAVPRL 567 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 362 Length of database: 570 Length adjustment: 33 Effective length of query: 329 Effective length of database: 537 Effective search space: 176673 Effective search space used: 176673 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory