Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_028488909.1 Q394_RS0108480 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000621325.1:WP_028488909.1 Length = 369 Score = 195 bits (496), Expect = 1e-54 Identities = 105/294 (35%), Positives = 176/294 (59%), Gaps = 24/294 (8%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 + + N+SK F +V L + N+ I++GE F ILGPSG GKTT +R+IAG + P+ G++ Sbjct: 7 LTLSNISKRFASQEV--LSDFNLTIQDGEFFTILGPSGCGKTTVLRLIAGFEQPNEGQIL 64 Query: 64 FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEE 123 + +A +P E R VFQ++AL+P+LT F+N+AF L + ++I RV + Sbjct: 65 LNGDDIAR-----IPAEKRPFNTVFQSYALFPHLTVFDNVAFGLKMAGVDVQDIAVRVAD 119 Query: 124 VAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALV 183 I+ + P +LSGGQ+QRVA+ARA+V P +LLLDE S LD ++R + + Sbjct: 120 ALAIVRLSEFATRKPHQLSGGQKQRVAIARAVVNRPKILLLDESLSALDYKLRQQMQLEL 179 Query: 184 KEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGE 243 K++Q +LG+T + V+HD + +++DR+ V+ G+ QVG P ++Y++P ++ VA IGE Sbjct: 180 KQLQRQLGITFVYVTHDQEEALSMSDRILVMHNGQAQQVGTPREIYESPRNLFVAQFIGE 239 Query: 244 INELEGKVTNEGVVIGSLRFPVSVS--------------SDRAIIGIRPEDVKL 283 IN +G++ +G ++ S++ D+ + +RPED+++ Sbjct: 240 INVFDGEIVQ---ALGEYQYEASINGVVREIRCDHRFAVGDKVHVMLRPEDLRI 290 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 369 Length adjustment: 29 Effective length of query: 324 Effective length of database: 340 Effective search space: 110160 Effective search space used: 110160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory