Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_211248857.1 Q394_RS0118475 glucose 1-dehydrogenase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_000621325.1:WP_211248857.1 Length = 255 Score = 113 bits (283), Expect = 3e-30 Identities = 77/251 (30%), Positives = 123/251 (49%), Gaps = 15/251 (5%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYI----CDVDPAAIDRARTAHPQLHAGVADVS 67 G V+I+GA++GIG A A AF G + + + A R + DV Sbjct: 11 GKVVVITGASSGIGEAAAHAFGREGCKLVLGARRAEEGEAVAAAIRATGGEAVFVCTDVL 70 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRK 127 A + R++ A GGLD+L NNAG G + A + AE++ T+ TN+ S + ++ Sbjct: 71 QEADIARLVQTALDTFGGLDVLFNNAGTEGVSSAFTEQSTAEYDFTMNTNVRSVLWGMQH 130 Query: 128 AVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAI 187 A+ ++ SA II AS+ +G+A Y+ASK A+VGM + A+E +R+NA+ Sbjct: 131 AIRAMQ--SAGGAIINNASIVAHVGFANTALYSASKAAVVGMTRVAAVEYFKQGIRINAV 188 Query: 188 LPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQ 247 PG+ R+ +G + + ++ R ++AA +FLAS Sbjct: 189 CPGITYTPMSQRL---------LGGEDEQNAFMATTPAGRTGQPEEIAAAVVFLASGNAS 239 Query: 248 NISGQAISVDG 258 ISGQ ++VDG Sbjct: 240 YISGQCLNVDG 250 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 255 Length adjustment: 24 Effective length of query: 239 Effective length of database: 231 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory