Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_211248857.1 Q394_RS0118475 glucose 1-dehydrogenase
Query= BRENDA::Q4J9F2 (255 letters) >NCBI__GCF_000621325.1:WP_211248857.1 Length = 255 Score = 126 bits (317), Expect = 4e-34 Identities = 86/256 (33%), Positives = 125/256 (48%), Gaps = 9/256 (3%) Query: 1 MSYQSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVL 60 +S Q+L KVV++TGA SGIG A A F +V + + +R G E + Sbjct: 4 LSNQNLAGKVVVITGASSGIGEAAAHAFGREGCKLVLGARRAEEGEAVAAAIRATGGEAV 63 Query: 61 GVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYS 120 V DV ++ D+ V+ +T+ +DVL NNAG + E S ++ + N+ S Sbjct: 64 FVCTDVLQEADIARLVQTALDTFGGLDVLFNNAGTEGVSSAFTEQSTAEYDFTMNTNVRS 123 Query: 121 AFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQG 180 + + I M G G I+N ASI G A Y+ +K ++G+TR A Y QG Sbjct: 124 VLWGMQHAIRAMQSAG-GAIINNASIVAHVGFANTALYSASKAAVVGMTRVAAVEYFKQG 182 Query: 181 IRAVAVLPGTVKTNIG---LGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDE 237 IR AV PG T + LG M T + + R +PE+IA +VFLAS Sbjct: 183 IRINAVCPGITYTPMSQRLLGGEDEQNAFMAT-----TPAGRTGQPEEIAAAVVFLASGN 237 Query: 238 ASFVNGDAVVVDGGLT 253 AS+++G + VDGG T Sbjct: 238 ASYISGQCLNVDGGYT 253 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory