Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_211248857.1 Q394_RS0118475 glucose 1-dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >NCBI__GCF_000621325.1:WP_211248857.1 Length = 255 Score = 124 bits (310), Expect = 3e-33 Identities = 81/251 (32%), Positives = 127/251 (50%), Gaps = 8/251 (3%) Query: 17 ERLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQGADVVAIK 76 + L KVV++TGA+ GIGEA F + +L++ + E+ E VAA R G + V + Sbjct: 7 QNLAGKVVVITGASSGIGEAAAHAFGREGCKLVLGARRAEEGEAVAAAIRATGGEAVFVC 66 Query: 77 ADVSRQQDLHAMARLAIDLHGRIDVLVNCAGV-NVFRDPLEMTEEDWRRCFAIDLDGAWY 135 DV ++ D+ + + A+D G +DVL N AG V E + ++ ++ + Sbjct: 67 TDVLQEADIARLVQTALDTFGGLDVLFNNAGTEGVSSAFTEQSTAEYDFTMNTNVRSVLW 126 Query: 136 GCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRV 195 G + + M G G+IIN AS + Y +K ++G+TR +EY +G+R+ Sbjct: 127 GMQHAIRAMQSAG-GAIINNASIVAHVGFANTALYSASKAAVVGMTRVAAVEYFKQGIRI 185 Query: 196 NAIAPGYIETQLNVDYWNGFADPHAERQRAF-DLHPPRRIGQPIEVAMTAVFLASDEAPF 254 NA+ PG T ++ G + Q AF P R GQP E+A VFLAS A + Sbjct: 186 NAVCPGITYTPMSQRLLGG-----EDEQNAFMATTPAGRTGQPEEIAAAVVFLASGNASY 240 Query: 255 INASCITIDGG 265 I+ C+ +DGG Sbjct: 241 ISGQCLNVDGG 251 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 255 Length adjustment: 25 Effective length of query: 247 Effective length of database: 230 Effective search space: 56810 Effective search space used: 56810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory