Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate WP_028488909.1 Q394_RS0108480 spermidine/putrescine ABC transporter ATP-binding protein PotA
Query= reanno::Smeli:SMc02121 (258 letters) >NCBI__GCF_000621325.1:WP_028488909.1 Length = 369 Score = 145 bits (367), Expect = 9e-40 Identities = 84/247 (34%), Positives = 143/247 (57%), Gaps = 12/247 (4%) Query: 14 TTDVAIEITNMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEEHQKG 73 T + ++N++K + VL D NL + GE + GPSG GK+T++R I E+ +G Sbjct: 2 TRSPILTLSNISKRFASQEVLSDFNLTIQDGEFFTILGPSGCGKTTVLRLIAGFEQPNEG 61 Query: 74 KIVVDGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKEAEQV 133 +I+++G +D+ +I +R VFQ + LFPHLT+ +N KM + + + Sbjct: 62 QILLNG----DDIARIPAEKRPFNTVFQSYALFPHLTVFDNVAFG----LKMAGVDVQDI 113 Query: 134 AMHFLER---VKIPEQALKYPGQLSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEMVK 190 A+ + V++ E A + P QLSGGQ+QRVAIAR++ RPKILL DE SALD ++ + Sbjct: 114 AVRVADALAIVRLSEFATRKPHQLSGGQKQRVAIARAVVNRPKILLLDESLSALDYKLRQ 173 Query: 191 EVLDTMVGLAEE-GMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFFDNPQHERT 249 ++ + L + G+T + VTH+ A +++R++ M GQ + +P E +++P++ Sbjct: 174 QMQLELKQLQRQLGITFVYVTHDQEEALSMSDRILVMHNGQAQQVGTPREIYESPRNLFV 233 Query: 250 KLFLSQI 256 F+ +I Sbjct: 234 AQFIGEI 240 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 369 Length adjustment: 27 Effective length of query: 231 Effective length of database: 342 Effective search space: 79002 Effective search space used: 79002 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory