Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_028490400.1 Q394_RS0117595 ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000621325.1:WP_028490400.1 Length = 350 Score = 140 bits (354), Expect = 3e-38 Identities = 78/222 (35%), Positives = 126/222 (56%), Gaps = 4/222 (1%) Query: 48 VNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREF 107 V+ +SL++ G+I ++G SG GK+TL+R T G+I ++G+ L D + Sbjct: 19 VHAVSLTVEDGQIGCLLGPSGCGKTTLLRAIAGFESVTQGSITLNGQ--LISDHNTHLPP 76 Query: 108 RRHKISMVFQSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPH 167 + I MVFQ + L PH ++ DN+ +G +R +S Q A R + V L GY +YPH Sbjct: 77 EKRTIGMVFQDYALFPHLNIADNITFG--IRKQSSQDKARRVAELLELVNLPGYAKRYPH 134 Query: 168 QLSGGMRQRVGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITH 227 +LSGG +QR+ LARALA ++L+DE F + D +R + ++ ++ K T + +TH Sbjct: 135 ELSGGQQQRIALARALAPRPRLLLLDEPFGSQDVELREMLAREVRDILKREGMTAILVTH 194 Query: 228 DLDEAVRIGNRIAILKDGKLIQVGTPREILHSPADEYVDRFV 269 D EA + + I +L+ G+L Q T + H PA+ +V F+ Sbjct: 195 DQHEAFAMADEIGVLQQGRLQQWDTGYNLYHKPANAFVAGFI 236 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 350 Length adjustment: 27 Effective length of query: 249 Effective length of database: 323 Effective search space: 80427 Effective search space used: 80427 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory