Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_028490539.1 Q394_RS0118415 acetoacetyl-CoA reductase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_000621325.1:WP_028490539.1 Length = 242 Score = 121 bits (303), Expect = 2e-32 Identities = 80/248 (32%), Positives = 123/248 (49%), Gaps = 8/248 (3%) Query: 21 NKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKADVS 80 +KV L+TG GIG AI FA ++V + + E E A ++G +V DVS Sbjct: 2 SKVALVTGGTGGIGNAICKQFAEDGYKVVTTYFEPE--EQAKAWQAKQGYEVAIYPCDVS 59 Query: 81 NQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGCKAV 140 N D + + G++D++VNCAG+ ++T W +LD + Sbjct: 60 NYDDCVKLKESVIADFGQVDIIVNCAGITRDATFKKITPAHWAAVMKTNLDSVFNVTHQF 119 Query: 141 LPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAP 200 + +M E+G G +INI+S + G Y AK G+ G AL E A KGV +N ++P Sbjct: 120 VNEMAERGFGRVINISSINGQKGQFGQTNYSAAKAGVHGFGMALAQEVARKGVTINTLSP 179 Query: 201 GYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFINASCI 260 GYI T++ + A R + + P R+G P E+A FLASD+A FI + I Sbjct: 180 GYIATEMVM------AIAEEVRNKIIAQIPVGRLGTPEEMAAIVSFLASDKAGFITGANI 233 Query: 261 TIDGGRSV 268 + +GG+ + Sbjct: 234 SANGGQFI 241 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 242 Length adjustment: 24 Effective length of query: 248 Effective length of database: 218 Effective search space: 54064 Effective search space used: 54064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory