Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_028490400.1 Q394_RS0117595 ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_000621325.1:WP_028490400.1 Length = 350 Score = 184 bits (468), Expect = 2e-51 Identities = 108/288 (37%), Positives = 165/288 (57%), Gaps = 12/288 (4%) Query: 1 MSELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDL 60 MS+L L ++ Y V+ V L ++ G+ +GPSGCGK+TLLR IAG E ++ G + Sbjct: 1 MSKLTLQNIHIRYSNNAVVHAVSLTVEDGQIGCLLGPSGCGKTTLLRAIAGFESVTQGSI 60 Query: 61 TIDDVRMND----VDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNE 116 T++ ++D + P KR I MVFQ YAL+PH+ + +N+ F +R + +RV E Sbjct: 61 TLNGQLISDHNTHLPPEKRTIGMVFQDYALFPHLNIADNITFGIRKQS--SQDKARRVAE 118 Query: 117 AAHILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEI 176 ++ L R P +LSGGQ+QR+A+ RA+ P++ L DEP + D ELR + E+ Sbjct: 119 LLELVNLPGYAKRYPHELSGGQQQRIALARALAPRPRLLLLDEPFGSQDVELREMLAREV 178 Query: 177 ARLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGS 236 + K+ T + VTHDQ EA +AD+I V++ G ++Q + +LY PAN FVAGFIG Sbjct: 179 RDILKREGMTAILVTHDQHEAFAMADEIGVLQQGRLQQWDTGYNLYHKPANAFVAGFIGQ 238 Query: 237 PKMNFLKGVIEIDEDQAYARLPDYGDAKIPVTLQAAAGTAVTIGIRPE 284 + L G++ A A +GD +P + Q V++ IRP+ Sbjct: 239 GVL--LPGIVLNHNTVATALGNVHGD--VPESCQPEC--PVSVLIRPD 280 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 350 Length adjustment: 29 Effective length of query: 329 Effective length of database: 321 Effective search space: 105609 Effective search space used: 105609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory