Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate WP_038140452.1 Q394_RS19035 amino acid ABC transporter permease
Query= uniprot:Q88GX2 (236 letters) >NCBI__GCF_000621325.1:WP_038140452.1 Length = 348 Score = 89.7 bits (221), Expect = 7e-23 Identities = 67/213 (31%), Positives = 107/213 (50%), Gaps = 12/213 (5%) Query: 26 GLLVTAKLVAISFSLGAVLGLLLALARLSRSLVLQRMAAGYVYFFRGSPLLAQLFLLYYG 85 GL +T L ++S L +LLAL R+S V++ + YV RG PL++ LF+ + Sbjct: 139 GLPLTILLASLSVVGAFPLAVLLALGRMSDLPVIRSLCTVYVELIRGVPLISVLFMASF- 197 Query: 86 LGSLKGFWQDVGLWWFFRDAWFCTLLAFTLNTAAYQAEIFRGSLMAVAPGQHEAARALNL 145 L + VG D L+A L AY AE+ RG L A+ GQ+EAA +L L Sbjct: 198 ---LFPLFMPVGT---SIDVLLRVLVAMILFAGAYLAEVIRGGLQAIPRGQYEAAASLGL 251 Query: 146 KRSTTFFKVILPQSLLVAIGPLGNELILMIKASAIASLVTIYDLMGVTKLAFSRSFDF-- 203 K+ILPQ+L + + N I K +++ ++V++Y+L G LA + D+ Sbjct: 252 TYWQMQGKIILPQALATVVPGIMNNFISTFKDTSLVTIVSLYELTGSLDLAVNSDPDWLP 311 Query: 204 ---QIYLWAAVLYLVIVELVRRLLKHLEARLGR 233 + YL+ A +Y V + R + +E ++ R Sbjct: 312 YKLEGYLFIAAIYFVFCFSLSRYSQWVERQVSR 344 Lambda K H 0.331 0.144 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 348 Length adjustment: 26 Effective length of query: 210 Effective length of database: 322 Effective search space: 67620 Effective search space used: 67620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory