Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_028490400.1 Q394_RS0117595 ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000621325.1:WP_028490400.1 Length = 350 Score = 193 bits (491), Expect = 5e-54 Identities = 125/370 (33%), Positives = 199/370 (53%), Gaps = 27/370 (7%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 M+++ L++I+ Y V +L ++D + +GPSGCGKTT LR IAG E +T+G Sbjct: 1 MSKLTLQNIHIRYSNNA--VVHAVSLTVEDGQIGCLLGPSGCGKTTLLRAIAGFESVTQG 58 Query: 61 NLYIGDRRVND----VPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRV 116 ++ + + ++D +PP+ R I MVFQ+YAL+PH+ + N+ FG+ RK + RRV Sbjct: 59 SITLNGQLISDHNTHLPPEKRTIGMVFQDYALFPHLNIADNITFGI--RKQSSQDKARRV 116 Query: 117 QEAAKILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRA 176 E +++++ R P LSGGQ+QR+AL RA+ P++ L+DEP + D +LR + Sbjct: 117 AELLELVNLPGYAKRYPHELSGGQQQRIALARALAPRPRLLLLDEPFGSQDVELREMLAR 176 Query: 177 EIRKLHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFI 236 E+R + +R T I VTHDQ EA M D I V++ G +QQ DT +Y +P N FVAGFI Sbjct: 177 EVRDILKREGMTAILVTHDQHEAFAMADEIGVLQQGRLQQWDTGYNLYHKPANAFVAGFI 236 Query: 237 GSPAMNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDE 296 G + IV + + ++ +PE S PV + +RP+DL Sbjct: 237 G---QGVLLPGIVLNHNTVATALGNVHGDVPE--------SCQPECPVSVLIRPDDL--R 283 Query: 297 EVFMTTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYH-VGSSVKLAIDL 355 V + +P +V+ G+E ++ + + + P H H +G+SV + +DL Sbjct: 284 LVADSPHPATVISRGFR-----GAEYLYGLALNDGSQLLALTPSHQAHPIGASVCIELDL 338 Query: 356 NKIHIFDAET 365 + I T Sbjct: 339 QHLVILPTLT 348 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 350 Length adjustment: 30 Effective length of query: 354 Effective length of database: 320 Effective search space: 113280 Effective search space used: 113280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory