Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_028490400.1 Q394_RS0117595 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000621325.1:WP_028490400.1 Length = 350 Score = 206 bits (524), Expect = 7e-58 Identities = 107/239 (44%), Positives = 148/239 (61%), Gaps = 6/239 (2%) Query: 1 MGKITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQI 60 M K+TL+N+ R+ V+ ++ L +EDG+ +GPSGCGK+TLLR IAG E V+ G I Sbjct: 1 MSKLTLQNIHIRYSNNAVVHAVSLTVEDGQIGCLLGPSGCGKTTLLRAIAGFESVTQGSI 60 Query: 61 MIDGR----DATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSN 116 ++G+ T +PP KR + MVFQ YAL+PH+ + NI F +R K Q+ RRV+ Sbjct: 61 TLNGQLISDHNTHLPPEKRTIGMVFQDYALFPHLNIADNITFGIR--KQSSQDKARRVAE 118 Query: 117 AAKILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEI 176 +++NL Y R P +LSGGQ+QR+A+ RA+ P L DEP + D LR + E+ Sbjct: 119 LLELVNLPGYAKRYPHELSGGQQQRIALARALAPRPRLLLLDEPFGSQDVELREMLAREV 178 Query: 177 TELHQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIG 235 ++ + T I VTHDQ EA MAD+I VL GR++Q + LY PAN FVAGFIG Sbjct: 179 RDILKREGMTAILVTHDQHEAFAMADEIGVLQQGRLQQWDTGYNLYHKPANAFVAGFIG 237 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 350 Length adjustment: 28 Effective length of query: 304 Effective length of database: 322 Effective search space: 97888 Effective search space used: 97888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory