Align BadH (characterized)
to candidate WP_028490539.1 Q394_RS0118415 acetoacetyl-CoA reductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000621325.1:WP_028490539.1 Length = 242 Score = 144 bits (363), Expect = 2e-39 Identities = 84/245 (34%), Positives = 127/245 (51%), Gaps = 8/245 (3%) Query: 6 NKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCDIA 65 +K A++TGG GGIG A C++FA++G K+ + K A + G CD++ Sbjct: 2 SKVALVTGGTGGIGNAICKQFAEDGYKVVTTYFEPEEQAKAWQAKQ--GYEVAIYPCDVS 59 Query: 66 DRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHHAV 125 + + G VDI+VN AG F K P W ++ NL ++ H Sbjct: 60 NYDDCVKLKESVIADFGQVDIIVNCAGITRDATFKKITPAHWAAVMKTNLDSVFNVTHQF 119 Query: 126 LPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVVCP 185 + M ER GR++NI+S + G G+ Y+A K G+ F LA+E AR G+T+N + P Sbjct: 120 VNEMAERGFGRVINISSINGQKGQFGQTNYSAAKAGVHGFGMALAQEVARKGVTINTLSP 179 Query: 186 GPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQVL 245 G T ++ + N K+I IP+GRLG P+++A ++F SD AGFITG + Sbjct: 180 GYIATEMVMAIAEEVRN--KII----AQIPVGRLGTPEEMAAIVSFLASDKAGFITGANI 233 Query: 246 SVSGG 250 S +GG Sbjct: 234 SANGG 238 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 242 Length adjustment: 24 Effective length of query: 231 Effective length of database: 218 Effective search space: 50358 Effective search space used: 50358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory