Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate WP_028490382.1 Q394_RS0117500 NADH-quinone oxidoreductase subunit NuoF
Query= uniprot:Q39TW5 (635 letters) >NCBI__GCF_000621325.1:WP_028490382.1 Length = 426 Score = 331 bits (849), Expect = 3e-95 Identities = 171/402 (42%), Positives = 255/402 (63%), Gaps = 9/402 (2%) Query: 150 SMDDYLAIGGYSALSKVLFQMTPE-DVMGEIKKSNLRGRGGGGFPAWRKWEESRNAPDPI 208 +++ YL +GGYSA K+L + TP +V+ EIK S LRGRGG GFP KW Sbjct: 18 TLESYLKVGGYSAWKKILAEKTPAVEVIEEIKDSGLRGRGGAGFPTGMKWSFMPRDMPGQ 77 Query: 209 KYVIVNADEGDPGAFMDRALIEGNPHSILEGLIIGAYAVGAHEGFIYVRQEY---PLAVE 265 KY++ N+DE +PG DR ++ NPH+++EG+ I Y++GA G+ Y+R E+ P Sbjct: 78 KYIVCNSDESEPGTCKDRDILRFNPHALVEGMAIAGYSIGATVGYNYMRGEFMDEPFI-- 135 Query: 266 NINLAIRQASERGFVGKDILGSGFDFTVKVHMGAGAFVCGESSALMTALEGRAGEPRPKY 325 + A+++A E G +GK+I GSG DF + +GAGA+VCGE +AL+ +LEG+ G+PR K Sbjct: 136 HFEQAVKEAYEMGLLGKNIQGSGVDFDLHGTLGAGAYVCGEETALLESLEGKKGQPRFKP 195 Query: 326 IHTAVKGVWDHPSVLNNVETWANVTQIITKGADWFTSYGTAGSTGTKIFSLVGKITNTGL 385 A G++ P+ +NN ET A++ I+ G WF G S G K+FS+ G + N G Sbjct: 196 PFPASFGLYGRPTTINNTETLASIPVIMRNGGKWFADLGVKNSGGEKLFSMSGHLNNPGN 255 Query: 386 VEVPMGVTLRDIITKVGGGIPGGKKFKAVQTGGPSGGCIP-EAMLDLPVDFDELTKAGSM 444 E+PMG+ +++ + GG+ G+K KAV GG S +P E M+ L +D+D ++KAGS Sbjct: 256 FEIPMGMPFPELLA-LAGGVRNGRKLKAVIPGGSSVPVLPGEVMMGLTMDYDTISKAGSY 314 Query: 445 MGSGGMIVMDEDTCMVDIARYFIDFLKDESCGKCTPCREGIRQMLAVLTRITVGKGKEGD 504 +GSG +IVMD+ T MV + + F ESCG+CTPCREG + +LTRI GKGK D Sbjct: 315 LGSGAVIVMDDTTDMVKVLQRISRFYFSESCGQCTPCREGTGWLYRMLTRIVEGKGKLED 374 Query: 505 IELLEELAES-TGAALCALGKSAPNPVLSTIRYFRDEYEAHI 545 + LEE++ + G ++CALG++A PV S +++FR+E+E ++ Sbjct: 375 VTRLEEISHNIEGRSICALGEAAAMPVWSFVKHFREEFEYYV 416 Lambda K H 0.319 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 767 Number of extensions: 48 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 635 Length of database: 426 Length adjustment: 35 Effective length of query: 600 Effective length of database: 391 Effective search space: 234600 Effective search space used: 234600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory