Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_028488593.1 Q394_RS0106660 urea ABC transporter ATP-binding subunit UrtE
Query= uniprot:G8ALJ1 (236 letters) >NCBI__GCF_000621325.1:WP_028488593.1 Length = 231 Score = 161 bits (407), Expect = 1e-44 Identities = 91/232 (39%), Positives = 140/232 (60%), Gaps = 3/232 (1%) Query: 1 MLKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITF 60 MLKV ++ +YG L +D+++ GE L+G NG GK+TLL I G +AR G I + Sbjct: 1 MLKVEQLNQYYGESHTLWNLDMQVPEGECTVLMGRNGVGKTTLLQCIMGLIKARDGVIQY 60 Query: 61 EGQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFANELERVLTLF 120 +GQ++ ++ + LGI P+GR+IFP ++V ENL +G + A+ + + LF Sbjct: 61 QGQNLLEVDAEKRANLGIGYVPQGRQIFPLLTVEENLLIG-LPARRDKVRSIPPFIFELF 119 Query: 121 PRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDIN 180 P LKE + +R G +SGG+QQ LAIGRAL+ P+LL+LDEP+ G+ P +V +I ++ +N Sbjct: 120 PVLKEMLGRRGGDLSGGQQQQLAIGRALVLDPKLLILDEPTEGIQPNIVAEIGDIIRKLN 179 Query: 181 REQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYL 232 ++ +TV +VEQ A K+ R ++ G+ G AEL NE + YL Sbjct: 180 KDIGLTVLLVEQKLPFARKVGDRFCILDRGQQVAQGAMAEL--NEGLIQRYL 229 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 231 Length adjustment: 23 Effective length of query: 213 Effective length of database: 208 Effective search space: 44304 Effective search space used: 44304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory