Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_028488587.1 Q394_RS0106625 ATP-binding cassette domain-containing protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_000621325.1:WP_028488587.1 Length = 257 Score = 141 bits (356), Expect = 1e-38 Identities = 90/253 (35%), Positives = 137/253 (54%), Gaps = 17/253 (6%) Query: 25 EDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEV 84 E L +I R G LN +SL G + ++G SGSGKSTL+R IN L P GEV Sbjct: 4 EHALVVNNIKKRFGDLAVLNGISLTAHKGDVISLLGSSGSGKSTLLRCINLLETPDEGEV 63 Query: 85 LFDGDNIL---DLGAKALRAFRMR------RVSMVFQSFALMPHRTVLQNVVYGQ-RVRG 134 G+ I D K + + + R+ MVFQ F L HRT+L N++ V G Sbjct: 64 YVTGERIEMTHDRHGKTIPKSQKQVDHIRTRLGMVFQGFNLWSHRTILDNIIEAPVHVLG 123 Query: 135 VSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSAL 194 + K +A+E ++ + VG++ +P LSGG +QRV +ARALA V+L DE SAL Sbjct: 124 IPKAEAKEYALELLHKVGIASKADSYPDHLSGGQQQRVAIARALAMKPAVMLFDEPTSAL 183 Query: 195 DPLIRGDMQDQLLQLQRNLA---KTIVFITHDLDEALRIGSEIAILRDGQVVQVGTPNDI 251 DP + G ++L++ R LA T++ +TH++ A + S++ L GQ+ + G+P + Sbjct: 184 DPELVG----EVLRVMRQLADEGMTMLVVTHEMGFAREVSSQVIFLHQGQIEEQGSPEQV 239 Query: 252 LDNPANDYVARFV 264 NP ++ +F+ Sbjct: 240 FGNPISERCQQFL 252 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 257 Length adjustment: 25 Effective length of query: 250 Effective length of database: 232 Effective search space: 58000 Effective search space used: 58000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory