Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_245606761.1 Q394_RS0109245 pyruvate carboxylase
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_000621325.1:WP_245606761.1 Length = 1169 Score = 348 bits (893), Expect = e-100 Identities = 194/464 (41%), Positives = 284/464 (61%), Gaps = 11/464 (2%) Query: 3 PFSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPA-LDS 61 P +++LVANRGEIA R+L+A E+ + ++VY+ D+++ H ADEAY IGK L Sbjct: 26 PINKLLVANRGEIAIRILRAASELKLRTVSVYTYEDRFSPHRYKADEAYQIGKDDEPLKP 85 Query: 62 YLNIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDG 121 YL+IE II A++ HVDAIHPGYGFLSEN FA + GI FIGP+ E M+K+ DK+ Sbjct: 86 YLDIEAIIKVAKRNHVDAIHPGYGFLSENVTFARRCREEGIIFIGPTPEAMQKLGDKVAA 145 Query: 122 KRLANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMD 181 K +A +G+P S P+ +++ A + A++IGYP+M+KAASGGGG G+ + QL Sbjct: 146 KEIAIASGLPVIEDSREPLDTLEIAKREADRIGYPLMMKAASGGGGRGMRVLREPSQLEG 205 Query: 182 VWERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLI 241 + + A +AFG A +F+EKY +P+HIE Q++GD +GN V +ER+C++QRR QK++ Sbjct: 206 AYNDARNEALKAFGDATVFLEKYIDSPKHIEIQILGDTHGNIVHLYERDCSVQRRFQKVV 265 Query: 242 EEAPSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHP 301 E APS LK E RE++++ + + ++Y GT E D YF+E+N R+QVEH Sbjct: 266 EVAPSTGLKDETRENLYKYALAITRHVDYSCAGTVE-FLVDKDERIYFIEVNPRVQVEHT 324 Query: 302 TTELIFRIDLVKLQIKLAAGEHLPF------SQEDLNKRVRGTAIEYRINAEDALNNFTG 355 TE I ID+V+ QI +A G L SQE + G A++ RI ED N F Sbjct: 325 ITEEITGIDIVRSQILIAGGAKLDDPEIGIPSQESV--ECNGYAVQCRITTEDPENGFKP 382 Query: 356 SSGFVTYYREPTGPGVRVDSGIE-SGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALAD 414 G + YR G GVR+D+G G+ V P++DS++ K+ +G S E A +RAL + Sbjct: 383 DYGTIIAYRSSGGFGVRLDAGAAYPGAKVSPFFDSMLVKVTTWGRSLEGASNRNLRALQE 442 Query: 415 YKIGGIKTTIELYKWIMQDPDFQEGKFSTSYISQKTDQFVKYLR 458 ++I G+KT I + ++Q P F GK + ++I + F LR Sbjct: 443 FRIRGVKTNIGFLENVLQHPVFTTGKCTVTFIDNHPELFHTALR 486 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1249 Number of extensions: 50 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 1169 Length adjustment: 41 Effective length of query: 468 Effective length of database: 1128 Effective search space: 527904 Effective search space used: 527904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory