Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate WP_028490539.1 Q394_RS0118415 acetoacetyl-CoA reductase
Query= SwissProt::Q9HK58 (254 letters) >NCBI__GCF_000621325.1:WP_028490539.1 Length = 242 Score = 121 bits (304), Expect = 1e-32 Identities = 79/246 (32%), Positives = 131/246 (53%), Gaps = 6/246 (2%) Query: 7 KNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHKVKVDQS 66 K A++TGG+ GIG AI A+ G ++ +Y + +A +K G + D S Sbjct: 3 KVALVTGGTGGIGNAICKQFAEDGYKVVTTYFEPEEQAKA---WQAKQGYEVAIYPCDVS 59 Query: 67 DPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHYFITQRI 126 + + ++ E I FG+V I+V+ AGI F +I+ + V K N++S + +T + Sbjct: 60 NYDDCVKLKESVIADFGQVDIIVNCAGITRDATFKKITPAHWAAVMKTNLDSVFNVTHQF 119 Query: 127 AKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKYGILVNSLE 186 M E GR++ ISSI+ G QT+Y+ K+ ++GF ++A + + G+ +N+L Sbjct: 120 VNEMAERGF-GRVINISSINGQKGQFGQTNYSAAKAGVHGFGMALAQEVARKGVTINTLS 178 Query: 187 PGTILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYVTGTELLAD 246 PG I T++ +E R + + VGRLG PE+M A FL SD ++TG + A+ Sbjct: 179 PGYIATEMVM--AIAEEVRNKIIAQIPVGRLGTPEEMAAIVSFLASDKAGFITGANISAN 236 Query: 247 GGMLIN 252 GG I+ Sbjct: 237 GGQFIH 242 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 242 Length adjustment: 24 Effective length of query: 230 Effective length of database: 218 Effective search space: 50140 Effective search space used: 50140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory