Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate WP_028488570.1 Q394_RS0106530 fumarylacetoacetate hydrolase family protein
Query= reanno::Smeli:SM_b21112 (281 letters) >NCBI__GCF_000621325.1:WP_028488570.1 Length = 294 Score = 178 bits (452), Expect = 1e-49 Identities = 93/226 (41%), Positives = 137/226 (60%), Gaps = 12/226 (5%) Query: 63 LGPCVAGTGKFICIGLNYSDHAAETGATV------PPEPIIFMKATSAIVGPNDDLVLPR 116 L P +C+GLNY +HA ET + P PI+F K ++++G D V+P Sbjct: 70 LAPIPRPRKNVMCLGLNYLEHAEETANQIGRTGKAPQYPIVFTKCPTSVIG--QDAVVPF 127 Query: 117 GSE---KTDWEVELGIVIGKTAKYVSEAEALDYVAGYCTVHDVSERAFQTERHGQWTKGK 173 + + DWE ELG+V+GK K ++ A ALD+V GY ++D+S R Q H Q+ GK Sbjct: 128 DPDTCSQLDWEAELGVVLGKGGKKIAAANALDHVFGYTVINDLSARDIQLS-HKQYFLGK 186 Query: 174 SCDTFGPTGPWLVTKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSL 233 S D P GPW+VT D++ADPQ+LA+ +VNG T Q +T+ M++ A ++ +LS+ M+L Sbjct: 187 SLDGGCPMGPWIVTADDIADPQNLAIACRVNGVTKQASNTRNMIFNVASIIEWLSRGMTL 246 Query: 234 RPGDIISTGTPPGVGMGMKPPRYLKAGDVVELGIEGLGSQKQRVRA 279 GD+I+TGTP GVG +PP +L GDVVE +E +G + + A Sbjct: 247 EAGDVIATGTPSGVGFVREPPEFLLPGDVVECEVESVGVLRNSISA 292 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 294 Length adjustment: 26 Effective length of query: 255 Effective length of database: 268 Effective search space: 68340 Effective search space used: 68340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory