Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_028490400.1 Q394_RS0117595 ABC transporter ATP-binding protein
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >NCBI__GCF_000621325.1:WP_028490400.1 Length = 350 Score = 200 bits (509), Expect = 4e-56 Identities = 128/347 (36%), Positives = 185/347 (53%), Gaps = 28/347 (8%) Query: 1 MASVTLRNIRKAYDENEVMRDINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGDL 60 M+ +TL+NI Y N V+ ++L + DG+ +GPSGCGK+TL+R IAG E ++ G + Sbjct: 1 MSKLTLQNIHIRYSNNAVVHAVSLTVEDGQIGCLLGPSGCGKTTLLRAIAGFESVTQGSI 60 Query: 61 TIDGMRVND----VAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRN 116 T++G ++D + P KR I MVFQ YAL+PH+ + DN+ FG++ K+ D A R Sbjct: 61 TLNGQLISDHNTHLPPEKRTIGMVFQDYALFPHLNIADNITFGIR----KQSSQDKA-RR 115 Query: 117 AAKILHIDHL---LDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMR 173 A++L + +L R P +LSGGQ+QR+A+ RA+ +P++ L DEP + D LR + Sbjct: 116 VAELLELVNLPGYAKRYPHELSGGQQQRIALARALAPRPRLLLLDEPFGSQDVELREMLA 175 Query: 174 LEFARLHDELKTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAGF 233 E + T I VTHDQ EA +AD+I VL G L+Q + LYH PAN FVAGF Sbjct: 176 REVRDILKREGMTAILVTHDQHEAFAMADEIGVLQQGRLQQWDTGYNLYHKPANAFVAGF 235 Query: 234 IGSPKMNFMEGVVQSVTHDGVTVRYETGETQRVAVE---PAAVKQGDKVTVGIRPEHLHV 290 IG Q V G+ + + T T V P + + V+V IRP+ L Sbjct: 236 IG-----------QGVLLPGIVLNHNTVATALGNVHGDVPESCQPECPVSVLIRPDDLR- 283 Query: 291 GMAEDGISARTMAVESLGDAAYLYAESSVAPDGLIARIPPLERHTKG 337 + D T+ A YLY + L+A P + H G Sbjct: 284 -LVADSPHPATVISRGFRGAEYLYGLALNDGSQLLALTPSHQAHPIG 329 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 350 Length adjustment: 29 Effective length of query: 340 Effective length of database: 321 Effective search space: 109140 Effective search space used: 109140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory