Align D-sorbitol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_028489032.1 Q394_RS0109205 SDR family oxidoreductase
Query= reanno::acidovorax_3H11:Ac3H11_2940 (244 letters) >NCBI__GCF_000621325.1:WP_028489032.1 Length = 242 Score = 376 bits (966), Expect = e-109 Identities = 185/241 (76%), Positives = 212/241 (87%) Query: 4 ARNLQGQVAAITGAASGIGFASAQTMADAGARVVLIDRDEAALAKACATIGPNALPLVLD 63 ++ L G+VAAITG ASGIG AS + M AGARVVLIDRDEAA+ G +PLV+D Sbjct: 2 SKALAGKVAAITGGASGIGLASLEAMLAAGARVVLIDRDEAAVMAIAEQQGDAVIPLVID 61 Query: 64 LLDARQCASLLQRTLALAGQLDIFHANAGLYVGGDLVDADPDAIDRMLNLNVNVVMKNVH 123 LLD ++CA ++ + L AGQLDIFHANAG+YVGGDLVDA+PDAIDRMLNLN+NVVMKNV Sbjct: 62 LLDPQRCAQMVPQILEKAGQLDIFHANAGMYVGGDLVDAEPDAIDRMLNLNINVVMKNVR 121 Query: 124 NVLPHMIERGTGDIIVTSSLAAHFPTPWEPVYASSKWAVNCFVQTVRRQVFKHGIRVGSI 183 +VLPHMI RGTGDIIVTSSLAAHFPTPWEPVYASSKWA++CFVQT RRQVFKHGIR+G++ Sbjct: 122 DVLPHMIARGTGDIIVTSSLAAHFPTPWEPVYASSKWAIDCFVQTTRRQVFKHGIRMGAV 181 Query: 184 SPGPVITSLLADWPAEKLAEAKASGSLIEAAEVAEVVLFMLTRPRGMTIRDVVMMPTNFD 243 SPGPVIT+LLADWPAEKL EAK SGSLIEA+EVA+V+LFMLTRPRG+TIRDVVM+PTNFD Sbjct: 182 SPGPVITALLADWPAEKLQEAKESGSLIEASEVADVILFMLTRPRGVTIRDVVMLPTNFD 241 Query: 244 L 244 L Sbjct: 242 L 242 Lambda K H 0.321 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 242 Length adjustment: 23 Effective length of query: 221 Effective length of database: 219 Effective search space: 48399 Effective search space used: 48399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory