Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_156946736.1 Q394_RS0103835 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_000621325.1:WP_156946736.1 Length = 242 Score = 137 bits (344), Expect = 4e-37 Identities = 83/238 (34%), Positives = 132/238 (55%), Gaps = 8/238 (3%) Query: 4 LELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAIL 63 +E VNK YG L++I+L++ GE +++ GPSG GKSTL+ CI LE+ G + Sbjct: 2 IEFAKVNKWYGHF--HVLRDIDLQVRRGERIVICGPSGSGKSTLIRCINRLESHQKGKLT 59 Query: 64 VDDADISG----MSPKDRDIAMVFQSYALYPTMSVRDNIAFG-LKIRKMPTAEIDEEVAR 118 VD+ ++S + R + MVFQ + L+P ++V +N+ +++ K+ E +E Sbjct: 60 VDNLELSDDVKVLHEVRRKVGMVFQQFNLFPHLTVLENLTLAPIQVNKLSKVEAEERAME 119 Query: 119 VSKLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEM 178 + +QI + P QLSGGQQQRVA+ R L P++ LFDEP S LD ++ E+ M Sbjct: 120 QLQRVQIAEQAYKYPLQLSGGQQQRVAIARTLCLTPQVLLFDEPTSALDPEMIKEVLDVM 179 Query: 179 KLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFI 236 + ++ T + VTH+ A ++ D+V M G I + P D +N P N +F+ Sbjct: 180 TELAEQ-GITMLCVTHEMGFAKSVADRVIFMDQGQIVEENNPHDFFNRPRNERTQAFL 236 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 242 Length adjustment: 27 Effective length of query: 359 Effective length of database: 215 Effective search space: 77185 Effective search space used: 77185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory