Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_028490400.1 Q394_RS0117595 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000621325.1:WP_028490400.1 Length = 350 Score = 200 bits (508), Expect = 5e-56 Identities = 123/346 (35%), Positives = 184/346 (53%), Gaps = 23/346 (6%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 M+ + + I+ Y + ++L +EDG+ +GPSGCGK+TLLR +AG E V+ G I Sbjct: 1 MSKLTLQNIHIRYSNNAVVHAVSLTVEDGQIGCLLGPSGCGKTTLLRAIAGFESVTQGSI 60 Query: 61 EIGGRDV----TTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAE 116 + G+ + T + P R + MVFQ YAL+PH+ + +N+ FG++ + R R+AE Sbjct: 61 TLNGQLISDHNTHLPPEKRTIGMVFQDYALFPHLNIADNITFGIRKQSSQDKAR--RVAE 118 Query: 117 AARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVEL 176 ++ L Y R P +LSGGQ+QR+A+ RA+ P + L DEP + D +LR + E+ Sbjct: 119 LLELVNLPGYAKRYPHELSGGQQQRIALARALAPRPRLLLLDEPFGSQDVELREMLAREV 178 Query: 177 EGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGS 236 + K+ G T I VTHDQ EA MAD+I VL +GR++Q + +LYHKP + FVA FIG Sbjct: 179 RDILKREGMTAILVTHDQHEAFAMADEIGVLQQGRLQQWDTGYNLYHKPANAFVAGFIGQ 238 Query: 237 P------AMNVFSSDVGLQDISLDASAAFVGCRPE---HIEIVPD-----GDGHIAATVH 282 +N + L ++ D + C+PE + I PD D ATV Sbjct: 239 GVLLPGIVLNHNTVATALGNVHGDVPES---CQPECPVSVLIRPDDLRLVADSPHPATVI 295 Query: 283 VKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRL 328 + G E L L L G Q++A +GA+V + L Sbjct: 296 SRGFRGAEYLYGLALNDGSQLLALTPSHQAHPIGASVCIELDLQHL 341 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 350 Length adjustment: 29 Effective length of query: 309 Effective length of database: 321 Effective search space: 99189 Effective search space used: 99189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory