Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate WP_028489708.1 Q394_RS0113310 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >NCBI__GCF_000621325.1:WP_028489708.1 Length = 297 Score = 137 bits (345), Expect = 4e-37 Identities = 71/206 (34%), Positives = 121/206 (58%), Gaps = 6/206 (2%) Query: 21 LKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGGAIMIGDQDVSGMSPKDRDIA 80 L + L I +GEF+ ++G SGCGKST++N +AGL T G +++ ++V P+ A Sbjct: 30 LDKVNLRINKGEFVSIIGHSGCGKSTVLNIVAGLYKATEGGVILDGREVDEPGPER---A 86 Query: 81 MVFQSYALYPTMSVRENIEFGLKI---RKMPQADIDAEVARVAKLLQIEHLLNRKPGQLS 137 +VFQ+++L P ++ EN+E +K K +A++ A + L+ ++H ++++P ++S Sbjct: 87 VVFQNHSLLPWLTAYENVELAVKQVFKGKKSKAEMKAWIEHNLHLVHMDHAMHKRPDEIS 146 Query: 138 GGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMHQRLKTTTVYVTHDQI 197 GG +QRV + RALA P++ L DEP LDA R ++ M + L T + +THD Sbjct: 147 GGMKQRVGIARALAMEPQVLLLDEPFGALDALTRAHLQDSMMEIQADLGNTVIMITHDVD 206 Query: 198 EAMTLGDKVAVMKDGIIQQFGTPKEI 223 EA+ L D++ +M +G G E+ Sbjct: 207 EAVLLSDRIVMMTNGPAASVGDILEV 232 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 297 Length adjustment: 28 Effective length of query: 358 Effective length of database: 269 Effective search space: 96302 Effective search space used: 96302 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory