Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate WP_043769867.1 U743_RS16355 aldehyde dehydrogenase family protein
Query= BRENDA::P23883 (495 letters) >NCBI__GCF_000733765.1:WP_043769867.1 Length = 494 Score = 348 bits (894), Expect = e-100 Identities = 197/482 (40%), Positives = 280/482 (58%), Gaps = 10/482 (2%) Query: 19 ENRLFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLS 78 E R FI GE+ + E DP ++ L I + +D+A+ AAR F WS Sbjct: 15 EGRNFIAGEWRDESGAERITVTDPASETVLGDIPCSSAATVDKAVRAARKAFNDPAWSNL 74 Query: 79 SPAKRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKV 138 +P +R+A+L++LA L+E HA++LA +E+LD GKPI S D+P +A+ + ++A K+ Sbjct: 75 APMEREALLHRLAALVEQHADDLATIESLDNGKPIAFSSTLDVPLSAQWLHYFAGWPSKL 134 Query: 139 YGE-----VATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPS 193 G V T SH A +R+PVGV+ AIVPWNFPL+L WKL PALAAGN+V++KP+ Sbjct: 135 SGRSMHPAVQPTGSHH-AYTLRQPVGVVGAIVPWNFPLVLAIWKLAPALAAGNTVVIKPA 193 Query: 194 EKSPLSAIRLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLL 253 E++P S ++LA L + AG P GV+NVV G G GQA+ H +D I+FTGST GK LL Sbjct: 194 EQTPYSLLKLAELIEAAGFPPGVVNVVLGDGRTTGQAIVDHPGVDKISFTGSTAVGKHLL 253 Query: 254 KDAGDSNMKRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEES 313 A +++KRV LE GGKS ++ D DL+ A A +F N GQ+C AGTRL Sbjct: 254 TSAA-NDLKRVTLELGGKSPTVILPDA-DLETAIPGAAQAVFVNSGQICFAGTRLFAPRK 311 Query: 314 IADEFLALLKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLL--DGR 371 D L + + A+++ G LDP + +G ++ DS+ + G G GR Sbjct: 312 HFDRILEGVAEAAKSFPVGAGLDPNSMLGPVVSQQQMDSILGKVEAGVKAGASTFCGGGR 371 Query: 372 NAGLAAAIGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWT 431 + PTI V D REEIFGPVL TR+ + + +ANDS+YGL A ++T Sbjct: 372 LDREGYFLEPTILVTDDAQNPAYREEIFGPVLTATRYDELDDIIAMANDSEYGLSANLYT 431 Query: 432 RDLSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWI 491 AHR++ +L+AG+V++N D +PFGG+KQSG GR+ +TE K++ Sbjct: 432 SHFGLAHRLAAQLQAGTVWINTQLSPDPHIPFGGFKQSGWGRENGEDVFAHYTETKSVIA 491 Query: 492 SL 493 SL Sbjct: 492 SL 493 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 605 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 494 Length adjustment: 34 Effective length of query: 461 Effective length of database: 460 Effective search space: 212060 Effective search space used: 212060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory