Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_037573817.1 BS73_RS18100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_000744815.1:WP_037573817.1 Length = 369 Score = 290 bits (743), Expect = 3e-83 Identities = 173/353 (49%), Positives = 221/353 (62%), Gaps = 6/353 (1%) Query: 14 GDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIGGDHMNYRVPQ 73 GD AVD L L+I D EFLVLVGPSGCGKST+LRMLAGLE +G I IG + + P+ Sbjct: 16 GDKPAVDALDLEIADGEFLVLVGPSGCGKSTSLRMLAGLEDVNNGAIRIGERDVTHLPPK 75 Query: 74 NRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAETLGIADLLDRKPD 133 +RDIAMVFQ+YALYPHMTV N+ F L+ G AE +V E A+ L + + LDRKP Sbjct: 76 DRDIAMVFQNYALYPHMTVADNMGFALKIA-GVNKAEIRSKVEEAAKILDLTEFLDRKPK 134 Query: 134 ELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQDQLAVTTVYVTH 193 LSGGQ+QRVA+GRAIVR+P+VFLMDEPLSNLDAKLR RT++ LQ +L +TTVYVTH Sbjct: 135 ALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAGLQRRLGITTVYVTH 194 Query: 194 NQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMINLVRGTRSE-STF 252 +Q EAMTM DR+AV+ DG LQQV +P Y P NLFVA FIG P +NLV ++ Sbjct: 195 DQVEAMTMGDRVAVLKDGLLQQVDTPRNMYDRPANLFVAGFIGSPAMNLVEVPITDGGVK 254 Query: 253 VGEHFSYPLDEDVMESVDDRDDFV-LGVRPEDIEVADAAPDDAALDDHDLQMDVTVVEPH 311 GE + V E+ + D V +GVRPE +++ + +D L + V VVE Sbjct: 255 FGESVVQVSRDAVGEAANAGDKTVTVGVRPEHLDIVGGT--EGGGEDKGLAVTVNVVEEL 312 Query: 312 GDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTVTIPPDKIHLFDAETG 364 G ++ S D + V G + +GD++ V + H+F TG Sbjct: 313 GADGYVYGSAKVGTETIDLVVRV-GGRDIPMKGDQLRVVPRAGETHVFSTSTG 364 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 369 Length adjustment: 30 Effective length of query: 353 Effective length of database: 339 Effective search space: 119667 Effective search space used: 119667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory